Teduglutide for Use

Teduglutide, also known as Gattex/ALX 0600, is mainly used for the treatment of short bowel syndrome (SBS). Creative Peptides has tried to discover more effective methods for meeting the increasing demands from a full range of scientific groups. Spec...

Teduglutide, also known as Gattex/ALX 0600, is mainly used for the treatment of short bowel syndrome (SBS). Creative Peptides has tried to discover more effective methods for meeting the increasing demands from a full range of scientific groups. Specifically, its teduglutide is indicated for the treatment of intestinal failure associated with SBS, which can help the researchers gain more information about peptide secreted primarily in the distal intestine and involved in the regeneration and repair of the intestinal epithelium, such as Acetyl octapeptide-1.. CAT#: M3412132 CAS No.: 197922-42-2 Sequence: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD M.W/Mr.: 3752.13 Molecular Formula: C164H252N44O55S Contact Address: 45-16 Ramsey Road, Shirley, NY 11967, USA Tel: 16316244882 Fax: 16316147828 Europe Tel: 44-207-048-3343 Email: [email protected]