Healthcare
Manta has 84 businesses under Healthcare in Shirley, NY
Featured Company Listings
45-1 Ramsey Road, Shirley, NY 11967, USA
Shirley, NY
(631) 626-9181
CLAIMED
Categorized under Health Services
Creative Animodel is an experienced bioscience CRO providing preclinical services including PD, PK, toxicology services and the establishment of tumor-bearing animal models, the supply of tumor cell lines and tissues, and the support of tumor related biotechniques.
45-1 Ramsey Road, Shirley, NY 11967, USA
Shirley, NY
(631) 626-9181
CLAIMED
Categorized under Health Services
TMEM51 Full-Length MS Protein Standard (NP_001129689), Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine, was produced in human 293
45-1 Ramsey Road, Shirley, NY 11967, USA
Shirley, NY
(631) 626-9181
CLAIMED
Categorized under Health Services
Creative Animodel is an experienced bioscience CRO providing preclinical services including PD, PK, toxicology services and the establishment of tumor-bearing animal models, the supply of tumor cell lines and tissues, and the support of tumor related biotechniques.
45-1 Ramsey Road, Shirley, NY 11967, USA
Shirley, NY
(631) 626-9181
CLAIMED
Categorized under Health Services
Creative Animodel is an experienced bioscience CRO providing preclinical services including PD, PK, toxicology services and the establishment of tumor-bearing animal models, the supply of tumor cell lines and tissues, and the support of tumor related biotechniques.
CLAIMED
Hearing Aids
Audiology Services
I have been practicing for 23 years! Finally, opened my own practice where I can give my patients the time and attention they deserve. I provide audiology services and hearing aids. Second location in Riverhead, NY at 806 E. Main St.
45-1 Ramsey Road, Shirley, NY 11967, USA
Shirley, NY
(631) 626-9181
CLAIMED
Categorized under Health Services
Creative Animodel is an experienced bioscience CRO providing preclinical services including PD, PK, toxicology services and the establishment of tumor-bearing animal models, the supply of tumor cell lines and tissues, and the support of tumor related biotechniques.
http://www.creative-animodel.com/
Shirley, NY
(631) 626-9181
CLAIMED
Categorized under Health Services
Creative Animodel is an experienced bioscience CRO providing preclinical services including PD, PK, toxicology services and the establishment of tumor-bearing animal models, the supply of tumor cell lines and tissues, and the support of tumor related biotechniques.
CLAIMED
Arthritis
Neck Pain
Sciatica
Shoulder Pain
Headaches
South Shore Chiropractic is a full-service chiropractic practice providing services to patients at two locations in Farmingville and Shirley, New York. The team of highly-qualified providers includes Dr. Michael J. Campo, Dr. Jayesh Patel, and Dr. Marc Avvento. The practice treats patients with a variety of injuries and conditions, including: Arthritis, Neck Pain, Sciatica, Shoulder Pain, Headaches
CLAIMED
Chiropractors
Physical Therapy
Pain Management
And More!
New York Injury Associates, injury doctors in Yaphank, has a great team ready to respond to your requests in Yaphank, among many other places in New York City and Long Island. Our Website lets you choose which region you live in so we can send you our closest office building. If you have been injured and need to see a no fault insurance doctor in Yaphank, please contact us immediately. We are eager to help and always available. We value quality over quantity, that is who we are.
When you become injured due to a car crash, workers’ comp accident, or personal injury, knowing where to turn will save you from recovery and financial hassles. Thanks to our team’s multidisciplinary nature, we can work to pair you with the practitioner who can best meet your healing needs.
CLAIMED
Categorized under Dentists
Thank you for taking the time to learn more about Orthodontics and our Invisalign Certified orthodontists, Drs. Taynor, Sabo and Rienecker. With three accessible Long Island, NY locations (Port Jefferson Station, Shirley, and Wading River) our orthodontists and their experienced teams work hard to bring beautiful smiles to adults and children. Our state-of-the-art offices feature a combination of comfort and technology, with orthodontists who are sure to put a smile on your face. Please use this web site to learn more about orthodontics for children and adults including traditional braces, expansion appliances, TMJ treatment, snoring appliances, Sleep Apnea, sports mouth guards, clear braces, Invisalign (invisible) braces, and more.
All Company Listings
45-1 Ramsey Road, Shirley, NY 11967, USA
Shirley, NY
(631) 626-9181
CLAIMED
Categorized under Health Services
Creative Animodel is an experienced bioscience CRO providing preclinical services including PD, PK, toxicology services and the establishment of tumor-bearing animal models, the supply of tumor cell lines and tissues, and the support of tumor related biotechniques.
CLAIMED
Arthritis
Neck Pain
Sciatica
Shoulder Pain
Headaches
South Shore Chiropractic is a full-service chiropractic practice providing services to patients at two locations in Farmingville and Shirley, New York. The team of highly-qualified providers includes Dr. Michael J. Campo, Dr. Jayesh Patel, and Dr. Marc Avvento. The practice treats patients with a variety of injuries and conditions, including: Arthritis, Neck Pain, Sciatica, Shoulder Pain, Headaches
CLAIMED
Chiropractors
Physical Therapy
Pain Management
And More!
New York Injury Associates, injury doctors in Yaphank, has a great team ready to respond to your requests in Yaphank, among many other places in New York City and Long Island. Our Website lets you choose which region you live in so we can send you our closest office building. If you have been injured and need to see a no fault insurance doctor in Yaphank, please contact us immediately. We are eager to help and always available. We value quality over quantity, that is who we are.
When you become injured due to a car crash, workers’ comp accident, or personal injury, knowing where to turn will save you from recovery and financial hassles. Thanks to our team’s multidisciplinary nature, we can work to pair you with the practitioner who can best meet your healing needs.
45-1 Ramsey Road, Shirley, NY 11967, USA
Shirley, NY
(631) 626-9181
CLAIMED
Categorized under Health Services
TMEM51 Full-Length MS Protein Standard (NP_001129689), Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine, was produced in human 293
CLAIMED
Categorized under Health Facilities
CLAIMED
Categorized under Dentists
Thank you for taking the time to learn more about Orthodontics and our Invisalign Certified orthodontists, Drs. Taynor, Sabo and Rienecker. With three accessible Long Island, NY locations (Port Jefferson Station, Shirley, and Wading River) our orthodontists and their experienced teams work hard to bring beautiful smiles to adults and children. Our state-of-the-art offices feature a combination of comfort and technology, with orthodontists who are sure to put a smile on your face. Please use this web site to learn more about orthodontics for children and adults including traditional braces, expansion appliances, TMJ treatment, snoring appliances, Sleep Apnea, sports mouth guards, clear braces, Invisalign (invisible) braces, and more.
CLAIMED
Categorized under Health Services
CD Genomics, experts in dna & genome sequencing service, genotyping, health diagnostics, bioinformatics, custom cdna library development. Contact Us Today!
CLAIMED
Categorized under Health Services
Creative Biolabs’ technical experts have successfully established the proprietary complement therapeutics system.
CLAIMED
Categorized under Health Services
CD Genomics, experts in dna & genome sequencing service, genotyping, health diagnostics, bioinformatics, custom cdna library development. Contact Us Today!
CLAIMED
Categorized under Dentists
45-1 Ramsey Road, Shirley, NY 11967, USA
Shirley, NY
(631) 626-9181
CLAIMED
Categorized under Health Services
Creative Animodel is an experienced bioscience CRO providing preclinical services including PD, PK, toxicology services and the establishment of tumor-bearing animal models, the supply of tumor cell lines and tissues, and the support of tumor related biotechniques.
CLAIMED
Categorized under Health Services
CD Genomics, experts in dna & genome sequencing service, genotyping, health diagnostics, bioinformatics, custom cdna library development. Contact Us Today!
CLAIMED
Categorized under Health Services
Cells require proline due to the absence of the gene for proline synthesis, the block in the biosynthetic chain lies in the step converting glutamic acid to glutamine gamma serialdehyde.
SUITE 115, 17 Ramsey Road, Shirley, NY 11967, USA
Shirley, NY
(631) 386-8251
CLAIMED
Categorized under Health and allied services, nec
45-1 Ramsey Road, Shirley, NY 11967, USA
Shirley, NY
(631) 626-9181
CLAIMED
Categorized under Health Services
Creative Animodel is an experienced bioscience CRO providing preclinical services including PD, PK, toxicology services and the establishment of tumor-bearing animal models, the supply of tumor cell lines and tissues, and the support of tumor related biotechniques.
CLAIMED
Categorized under Health Services
Creative Biogene offers a trusted and efficient virology testing service for biotechnology products and clinic products.
CLAIMED
Categorized under Health Practitioners
CLAIMED
Chiropractic Care
Orthopedic Care
Physical Therapy
Pain Management
We at Your Injury Practice in Shirley, NY, recognize the significance of seeking appropriate medical attention following an accident. Our team of skilled injury doctors possess extensive experience and compassion in treating a diverse range of injuries, ranging from minor to severe soft tissue damage and traumatic brain injuries.
Our commitment lies in providing optimal medical care to our patients by utilizing cutting-edge diagnostic tools and treatment techniques. As a no-fault medical practice, we endeavor to simplify the process of obtaining medical treatment and compensation for our clients. We accept no-fault insurance and liaise with insurance companies directly to ensure that our patients receive the required care without any additional complexity.
45-16 Ramsey Road, Shirley, NY 11967, USA
Shirley, NY
(631) 624-4882
CLAIMED
Categorized under Health Services
Creative Peptides has tried to discover more effective methods for meeting the increasing demands from a full range of scientific groups. Specifically, its teduglutide is indicated for the treatment of intestinal failure associated with SBS, which can help the researchers gain more information about peptide secreted primarily in the distal intestine and involved in the regeneration and repair of the intestinal epithelium, such as Acetyl octapeptide-1..
CAT#: M3412132
CAS No.: 197922-42-2
Sequence: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD
M.W/Mr.: 3752.13
Molecular Formula: C164H252N44O55S
Contact
Address: 45-16 Ramsey Road, Shirley, NY 11967, USA
Tel: 16316244882
Fax: 16316147828
Europe
Tel: 44-207-048-3343
Email: [email protected]
CLAIMED
Categorized under Health Services
We provide high quality customized microarray services like Transcriptomics, Genomics & Epigenetics for microarray experiments on Agilent, Illumina and Nimblegen.
CLAIMED
Hearing Aids
Audiology Services
I have been practicing for 23 years! Finally, opened my own practice where I can give my patients the time and attention they deserve. I provide audiology services and hearing aids. Second location in Riverhead, NY at 806 E. Main St.
439 William Floyd Parkway
Shirley, NY
(631) 772-7000
CLAIMED
Categorized under Physical therapist
Suffolk Chiropractic Rehabilitation & Physical Therapy (SCR&PT) is a multidisciplinary Chiropractic and Physical Therapy practice located in Shirley, New York. Our team specializes in care for all ages, helping patients overcome everything from chronic pain to no-fault accidents and post-surgery rehabilitation. Our goal is to get you back to living a pain-free life.
45-1 Ramsey Road, Shirley, NY 11967, USA
Shirley, NY
(631) 626-9181
CLAIMED
Categorized under Health Services
Creative Animodel is an experienced bioscience CRO providing preclinical services including PD, PK, toxicology services and the establishment of tumor-bearing animal models, the supply of tumor cell lines and tissues, and the support of tumor related biotechniques.
CLAIMED
Categorized under Health Services
DNA diagnostics for hereditary genetic diseases like cancer. Get whole body genome sequencing with dna quantification kit to identify the risk of developing disease.
http://www.creative-animodel.com/
Shirley, NY
(631) 626-9181
CLAIMED
Categorized under Health Services
Creative Animodel is an experienced bioscience CRO providing preclinical services including PD, PK, toxicology services and the establishment of tumor-bearing animal models, the supply of tumor cell lines and tissues, and the support of tumor related biotechniques.
Categorized under Pediatricians
Categorized under Doctors
Categorized under Nurse Practitioners
Categorized under Doctors
Categorized under Health Services
Categorized under Dentist Offices
Shirley, NY
Categorized under Health Practitioners
45-1 Ramsey Road, Shirley, NY 11967, USA
Shirley, NY
(516) 669-8109
Categorized under Health and allied services, nec
Categorized under Health Facilities
Categorized under Physical therapist
Browse Subcategories
Browse Cities
There are 1,328 cities in
New York
with businesses in the Healthcare category. We've listed the top ten (based on number of businesses) above.
See all cities for Healthcare in
New York .